Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (90 species) not a true protein |
Species Scadoxus multiflorus [TaxId:82246] [188826] (7 PDB entries) |
Domain d3o9na_: 3o9n A: [182898] automated match to d1hvqa_ complexed with act, po4 |
PDB Entry: 3o9n (more details), 2.4 Å
SCOPe Domain Sequences for d3o9na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o9na_ c.1.8.0 (A:) automated matches {Scadoxus multiflorus [TaxId: 82246]} gnldiavywgqnfdersleatcdsgnyayviigflntfgggqtpaldisghspsglepqi khcqsknvkvllsiggpagpysldsrsdandlavylfnnfllppghsennpfgnavldgi dfhiehggpsqyqllanilssfrlkgtefaltaapqcvypdpnlgtvinsatfdaiwvqf ynnpqcsyssgnaealmnawrewsmkartkkvflgfpahpdaagsgymppakvkfhvfpa akksykfggimlwdsywdtvsqfsnkilgdgv
Timeline for d3o9na_: