Lineage for d3o9na_ (3o9n A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095900Species Scadoxus multiflorus [TaxId:82246] [188826] (7 PDB entries)
  8. 2095906Domain d3o9na_: 3o9n A: [182898]
    automated match to d1hvqa_
    complexed with act, po4

Details for d3o9na_

PDB Entry: 3o9n (more details), 2.4 Å

PDB Description: Crystal Structure of a new form of xylanase-A-amylase inhibitor protein(XAIP-III) at 2.4 A resolution
PDB Compounds: (A:) Haementhin

SCOPe Domain Sequences for d3o9na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o9na_ c.1.8.0 (A:) automated matches {Scadoxus multiflorus [TaxId: 82246]}
gnldiavywgqnfdersleatcdsgnyayviigflntfgggqtpaldisghspsglepqi
khcqsknvkvllsiggpagpysldsrsdandlavylfnnfllppghsennpfgnavldgi
dfhiehggpsqyqllanilssfrlkgtefaltaapqcvypdpnlgtvinsatfdaiwvqf
ynnpqcsyssgnaealmnawrewsmkartkkvflgfpahpdaagsgymppakvkfhvfpa
akksykfggimlwdsywdtvsqfsnkilgdgv

SCOPe Domain Coordinates for d3o9na_:

Click to download the PDB-style file with coordinates for d3o9na_.
(The format of our PDB-style files is described here.)

Timeline for d3o9na_: