SCOPe 2.04: Domain d3o8xd1: 3o8x D:2-112

Lineage for d3o8xd1 (3o8x D:2-112)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (19 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries)
Domain d3o8xd1: 3o8x D:2-112 [200020]
Other proteins in same PDB: d3o8xa1, d3o8xa2, d3o8xb_, d3o8xc1, d3o8xc2, d3o8xd2
automated match to d1lp9f1
complexed with gsl, nag

Details for d3o8xd1

PDB Entry: 3o8x (more details), 2.74 Å

PDB Description: recognition of glycolipid antigen by inkt cell tcr

PDB Compounds: (D:) Vbeta8.2 chimera (Mouse variable domain, Human T-cell receptor beta-2 chain C region constant domain)

SCOPe Domain Sequences for d3o8xd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o8xd1 b.1.1.1 (D:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

SCOPe Domain Coordinates for d3o8xd1:

Click to download the PDB-style file with coordinates for d3o8xd1.
(The format of our PDB-style files is described here.)

Timeline for d3o8xd1: