Lineage for d3o5za_ (3o5z A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.2: SH3-domain [50044] (2 families) 
Family b.34.2.0: automated matches [191375] (1 protein)
not a true familyProtein automated matches [190457] (10 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries) 
Domain d3o5za_: 3o5z A: [182817]
automated match to d1pnja_
complexed with cl, mpd
Details for d3o5za_
PDB Entry: 3o5z (more details), 2.01 Å
PDB Description: Crystal structure of the SH3 domain from p85beta subunit of phosphoinositide 3-kinase (PI3K)
PDB Compounds: (A:) Phosphatidylinositol 3-kinase regulatory subunit betaSCOPe Domain Sequences for d3o5za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o5za_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpegfqyralypfrrerpedlellpgdvlvvsraalqalgvaeggercpqsvgwmpglne
rtrqrgdfpgtyveflgpvala
SCOPe Domain Coordinates for d3o5za_:
Click to download the PDB-style file with coordinates for d3o5za_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3o5za_:
- d3o5za_ first appeared in SCOPe 2.01
- d3o5za_ appears in SCOPe 2.07
View in 3D
