Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.3: C2 set domains [49142] (8 proteins) |
Protein CD4 C2-set domains [49149] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49150] (31 PDB entries) |
Domain d3o2da2: 3o2d A:98-178 [233060] Other proteins in same PDB: d3o2da1, d3o2dl1, d3o2dl2 automated match to d1cdya2 |
PDB Entry: 3o2d (more details), 2.19 Å
SCOPe Domain Sequences for d3o2da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o2da2 b.1.1.3 (A:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvla
Timeline for d3o2da2: