Lineage for d3nv1a_ (3nv1 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2052020Species Human (Homo sapiens) [TaxId:9606] [187655] (78 PDB entries)
  8. 2052028Domain d3nv1a_: 3nv1 A: [182573]
    automated match to d1a3ka_
    complexed with ni

Details for d3nv1a_

PDB Entry: 3nv1 (more details), 1.5 Å

PDB Description: Crystal structure of human galectin-9 C-terminal CRD
PDB Compounds: (A:) Galectin 9 short isoform variant

SCOPe Domain Sequences for d3nv1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nv1a_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hpaypmpfittilgglypsksillsgtvlpsaqrfhinlcsgnhiafhlnprfdenavvr
ntqidnswgseerslprkmpfvrgqsfsvwilceahclkvavdgqhlfeyyhrlrnlpti
nrlevggdiqlthvqt

SCOPe Domain Coordinates for d3nv1a_:

Click to download the PDB-style file with coordinates for d3nv1a_.
(The format of our PDB-style files is described here.)

Timeline for d3nv1a_: