Lineage for d3ntea1 (3nte A:1-147)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
core: 5 helices; bundleSuperfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) 
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) Protein automated matches [190369] (6 species)
not a true protein
Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (7 PDB entries) 
Domain d3ntea1: 3nte A:1-147 [233045]
Other proteins in same PDB: d3ntea2, d3nteb2
automated match to d1e6jp2
complexed with fe, i3m, iod, na
Details for d3ntea1
PDB Entry: 3nte (more details), 1.95 Å
PDB Description: crystal structure of the wild-type full-length hiv-1 capsid protein
PDB Compounds: (A:) hiv-1 capsid proteinSCOPe Domain Sequences for d3ntea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ntea1 a.73.1.1 (A:1-147) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtn
nppipvgeiykrwiilglnkivrmysp
SCOPe Domain Coordinates for d3ntea1:
Click to download the PDB-style file with coordinates for d3ntea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ntea1:
- d3ntea1 first appeared in SCOPe 2.03
- d3ntea1 appears in SCOPe 2.05
- d3ntea1 appears in the current release, SCOPe 2.08
View in 3D
