Lineage for d3nsqa_ (3nsq A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
multihelical; 3 layers or orthogonally packed helicesSuperfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) 
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) 
Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species) Species Human (Homo sapiens) [TaxId:9606] [48511] (34 PDB entries)
Uniprot P19793 227-458
Domain d3nsqa_: 3nsq A: [182524]
automated match to d1lbda_
complexed with chz
Details for d3nsqa_
PDB Entry: 3nsq (more details), 2.6 Å
PDB Description: Crystal structure of tetrameric RXRalpha-LBD complexed with antagonist danthron
PDB Compounds: (A:) Retinoid X receptor, alphaSCOPe Domain Sequences for d3nsqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nsqa_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
dpvtnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkd
gillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskg
lsnpaevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkli
gdtpidtflmeml
SCOPe Domain Coordinates for d3nsqa_:
Click to download the PDB-style file with coordinates for d3nsqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3nsqa_:
- d3nsqa_ first appeared in SCOPe 2.01
- d3nsqa_ appears in SCOPe 2.04
- d3nsqa_ appears in SCOPe 2.06
- d3nsqa_ appears in the current release, SCOPe 2.08
View in 3D
