Lineage for d3n8da1 (3n8d A:2-128)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862338Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2862339Protein automated matches [226903] (40 species)
    not a true protein
  7. 2862472Species Staphylococcus aureus [TaxId:1280] [225145] (3 PDB entries)
  8. 2862477Domain d3n8da1: 3n8d A:2-128 [213785]
    Other proteins in same PDB: d3n8da2, d3n8db2, d3n8db3
    automated match to d1ehib1
    complexed with anp, cl, so4

Details for d3n8da1

PDB Entry: 3n8d (more details), 2.3 Å

PDB Description: Crystal structure of Staphylococcus aureus VRSA-9 D-Ala:D-Ala ligase
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3n8da1:

Sequence, based on SEQRES records: (download)

>d3n8da1 c.30.1.0 (A:2-128) automated matches {Staphylococcus aureus [TaxId: 1280]}
tkenicivfggksaehevsiltaqnvlnaidkdkyhvdiiyitndgdwrkqnnitaeiks
tdelhlengealeisqllkesssgqpydavfpllhgpngedgtiqglfevldvpyvgngv
lsaassm

Sequence, based on observed residues (ATOM records): (download)

>d3n8da1 c.30.1.0 (A:2-128) automated matches {Staphylococcus aureus [TaxId: 1280]}
tkenicivfggksaehevsiltaqnvlnaidkdkyhvdiiyitndgdwrkqnnitaeiks
tdelhleleisqllkesssgqpydavfpllngedgtiqglfevldvpyvgngvlsaassm

SCOPe Domain Coordinates for d3n8da1:

Click to download the PDB-style file with coordinates for d3n8da1.
(The format of our PDB-style files is described here.)

Timeline for d3n8da1: