Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Actinobacillus succinogenes [TaxId:339671] [225929] (4 PDB entries) |
Domain d3n6ha1: 3n6h A:7-138 [232972] Other proteins in same PDB: d3n6ha2, d3n6ha3, d3n6hb2, d3n6hb3, d3n6hc2, d3n6hd2, d3n6hd3 automated match to d4g8ta1 complexed with cl, mg, so4 |
PDB Entry: 3n6h (more details), 2.3 Å
SCOPe Domain Sequences for d3n6ha1:
Sequence, based on SEQRES records: (download)
>d3n6ha1 d.54.1.0 (A:7-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]} svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal teaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaalldlmg qflgvpvaellg
>d3n6ha1 d.54.1.0 (A:7-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]} svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal teaiphvvgrpisilnkivndmhnawtfelrvnavaaleaalldlmgqflgvpvaellg
Timeline for d3n6ha1: