Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (98 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [196443] (1 PDB entry) |
Domain d3n5md_: 3n5m D: [196444] automated match to d3drda_ complexed with cl, so4 |
PDB Entry: 3n5m (more details), 2.05 Å
SCOPe Domain Sequences for d3n5md_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n5md_ c.67.1.0 (D:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} namktkqtdellakdeqyvwhgmrpfspnsttvgakaegcwvediqgkryldgmsglwcv nsgygrkelaeaaykqlqtlsyfpmsqshepaiklaeklnewlggeyviffsnsgseane tafkiarqyyaqkgephrykfmsryrgyhgntmatmaatgqaqrryqyepfasgflhvtp pdcyrmpgiereniydvecvkevdrvmtwelsetiaafimepiitgggilmapqdymkav hetcqkhgallisdevicgfgrtgkafgfmnydvkpdiitmakgitsaylplsatavkre iyeafkgkgeyeffrhintfggnpaacalalknleiienenliersaqmgsllleqlkee igehplvgdirgkgllvgielvndketkepidndkiasvvnackekgliigrngmttagy nniltlapplvisseeiafvigtlktameri
Timeline for d3n5md_: