Lineage for d3n5md_ (3n5m D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1867328Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [196443] (1 PDB entry)
  8. 1867332Domain d3n5md_: 3n5m D: [196444]
    automated match to d3drda_
    complexed with cl, so4

Details for d3n5md_

PDB Entry: 3n5m (more details), 2.05 Å

PDB Description: crystals structure of a bacillus anthracis aminotransferase
PDB Compounds: (D:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

SCOPe Domain Sequences for d3n5md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n5md_ c.67.1.0 (D:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
namktkqtdellakdeqyvwhgmrpfspnsttvgakaegcwvediqgkryldgmsglwcv
nsgygrkelaeaaykqlqtlsyfpmsqshepaiklaeklnewlggeyviffsnsgseane
tafkiarqyyaqkgephrykfmsryrgyhgntmatmaatgqaqrryqyepfasgflhvtp
pdcyrmpgiereniydvecvkevdrvmtwelsetiaafimepiitgggilmapqdymkav
hetcqkhgallisdevicgfgrtgkafgfmnydvkpdiitmakgitsaylplsatavkre
iyeafkgkgeyeffrhintfggnpaacalalknleiienenliersaqmgsllleqlkee
igehplvgdirgkgllvgielvndketkepidndkiasvvnackekgliigrngmttagy
nniltlapplvisseeiafvigtlktameri

SCOPe Domain Coordinates for d3n5md_:

Click to download the PDB-style file with coordinates for d3n5md_.
(The format of our PDB-style files is described here.)

Timeline for d3n5md_: