Lineage for d3n3qb2 (3n3q B:444-748)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1275305Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1275306Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1275763Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 proteins)
    duplication: tandem repeat of two CCP-like domains
  6. 1275764Protein Catalase-peroxidase KatG [74754] (4 species)
    only the N-terminal CCP-like domain binds heme
  7. 1275765Species Burkholderia pseudomallei [TaxId:28450] [89093] (20 PDB entries)
    Uniprot P13029 Q939D2 35-748
  8. 1275817Domain d3n3qb2: 3n3q B:444-748 [213705]
    automated match to d2ccaa2
    complexed with cl, hem, mpd, mrd, na, niz

Details for d3n3qb2

PDB Entry: 3n3q (more details), 1.9 Å

PDB Description: crystal structure of the s324t variant of burkholderia pseudomallei katg with isonicotinic acid hydrazide bound
PDB Compounds: (B:) Catalase-peroxidase

SCOPe Domain Sequences for d3n3qb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n3qb2 a.93.1.3 (B:444-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
llwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgganga
rirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaa
knaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaql
ltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadad
vfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnld
rfdla

SCOPe Domain Coordinates for d3n3qb2:

Click to download the PDB-style file with coordinates for d3n3qb2.
(The format of our PDB-style files is described here.)

Timeline for d3n3qb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n3qb1