Lineage for d3mmsa_ (3mms A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2140829Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2141796Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2141797Protein automated matches [190781] (41 species)
    not a true protein
  7. 2142037Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189329] (1 PDB entry)
  8. 2142038Domain d3mmsa_: 3mms A: [181426]
    automated match to d1jysa_
    complexed with gol, q88

Details for d3mmsa_

PDB Entry: 3mms (more details), 1.6 Å

PDB Description: crystal structure of streptococcus pneumoniae mta/sah nucleosidase in complex with 8-aminoadenine
PDB Compounds: (A:) 5'-methylthioadenosine / S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d3mmsa_:

Sequence, based on SEQRES records: (download)

>d3mmsa_ c.56.2.0 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mkigiiaampeelaylvqhldnaqeqvvlgntyhtgtivshevvlvesgigkvmsamsva
ilavhfqvdalintgsagavaegiavgdvviadklayhdvdvtafgyaygqmaqqplyfe
sdktfvaqiqeslsqldqnwhlgliatgdsfvagndkieaikshfpevlavemegaaiaq
aahalnlpvlviramsdnanheaniffdefiieagrrsaqvllaflkal

Sequence, based on observed residues (ATOM records): (download)

>d3mmsa_ c.56.2.0 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mkigiiaampeelaylvqhldnaqeqvvlgntyhtgtivshevvlvesgigkvmsamsva
ilavhfqvdalintgsagavaegiavgdvviadklayhdvdvtafgyaygqmaqqplyfe
sdktfvaqiqeslqnwhlgliatgdsfvagndkieaikshfpevlavemegaaiaqaaha
lnlpvlviramsdnanheaniffdefiieagrrsaqvllaflkal

SCOPe Domain Coordinates for d3mmsa_:

Click to download the PDB-style file with coordinates for d3mmsa_.
(The format of our PDB-style files is described here.)

Timeline for d3mmsa_: