Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (26 species) not a true protein |
Species Verrillofungia concinna [TaxId:496660] [196369] (1 PDB entry) |
Domain d3mgfd_: 3mgf D: [196370] automated match to d2a46a_ |
PDB Entry: 3mgf (more details), 1.8 Å
SCOPe Domain Sequences for d3mgfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mgfd_ d.22.1.0 (D:) automated matches {Verrillofungia concinna [TaxId: 496660]} svikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvsh vfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhksk ftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyka akkilkmpgshyishrlvrktegnitelvedavahs
Timeline for d3mgfd_: