Lineage for d3mdea1 (3mde A:242-395)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708345Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
  6. 2708386Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species)
  7. 2708408Species Pig (Sus scrofa) [TaxId:9823] [47208] (3 PDB entries)
  8. 2708413Domain d3mdea1: 3mde A:242-395 [16594]
    Other proteins in same PDB: d3mdea2, d3mdeb2
    complexed with co8, fad

Details for d3mdea1

PDB Entry: 3mde (more details), 2.4 Å

PDB Description: crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate
PDB Compounds: (A:) medium chain acyl-coa dehydrogenase

SCOPe Domain Sequences for d3mdea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mdea1 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Pig (Sus scrofa) [TaxId: 9823]}
gagfkiamgtfdktrppvaagavglaqraldeatkyalerktfgkllaehqgisflladm
amkvelarlsyqraaweidsgrrntyyasiakayaadianqlatdavqvfggngfnteyp
veklmrdakiyqiyegtaqiqriiiarehigryk

SCOPe Domain Coordinates for d3mdea1:

Click to download the PDB-style file with coordinates for d3mdea1.
(The format of our PDB-style files is described here.)

Timeline for d3mdea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mdea2