Lineage for d3mcqa2 (3mcq A:136-308)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like foldSuperfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) 
Family d.139.1.0: automated matches [227182] (1 protein)
not a true familyProtein automated matches [226902] (12 species)
not a true protein
Species Methylobacillus flagellatus [TaxId:265072] [225899] (1 PDB entry) 
Domain d3mcqa2: 3mcq A:136-308 [213205]
Other proteins in same PDB: d3mcqa1
automated match to d3c9ua2
complexed with 1pe, na, peg, pg4, pge
Details for d3mcqa2
PDB Entry: 3mcq (more details), 1.91 Å
PDB Description: crystal structure of thiamine-monophosphate kinase (mfla_0573) from methylobacillus flagellatus kt at 1.91 a resolution
PDB Compounds: (A:) Thiamine-monophosphate kinaseSCOPe Domain Sequences for d3mcqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mcqa2 d.139.1.0 (A:136-308) automated matches {Methylobacillus flagellatus [TaxId: 265072]}
pgasllrstaradddiwvsgplgdaalalaaiqgryplsdtelaacgkalhqpqprvvlg
qalrglahsaldisdglladlghilehsqvgaevwlkaipksevvsahsqevaiqkmils
ggddyelcftastqhrqqiadigrqlsldmavigritdtqqlvihglddaplt
SCOPe Domain Coordinates for d3mcqa2:
Click to download the PDB-style file with coordinates for d3mcqa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3mcqa2:
- d3mcqa2 first appeared in SCOPe 2.03
- d3mcqa2 appears in SCOPe 2.07
View in 3D
