Lineage for d3m94a_ (3m94 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962762Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2962763Protein automated matches [190708] (10 species)
    not a true protein
  7. 2962828Species Pig roundworm (Ascaris suum) [TaxId:6253] [189748] (2 PDB entries)
  8. 2962829Domain d3m94a_: 3m94 A: [180965]
    automated match to d1ej1b_
    complexed with ace, m7m

Details for d3m94a_

PDB Entry: 3m94 (more details), 2.05 Å

PDB Description: Complex crystal structure of Ascaris suum eIF4E-3 with m2,2,7G cap
PDB Compounds: (A:) Translation initiation factor 4E

SCOPe Domain Sequences for d3m94a_:

Sequence, based on SEQRES records: (download)

>d3m94a_ d.86.1.0 (A:) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
mrhplqchwalwylkadrskdwedclkqvavfdtvedfwslynhiqaasgltwgsdyylf
kegikpmwedennvkggrwlvvvdkqkraqlldhywlellmaiigeqfedngeyicgavv
nvrqkgdkvslwtrdslkddvnlrigqilkakleipdtepiryevhkdssvrtgsmvkpr
ivips

Sequence, based on observed residues (ATOM records): (download)

>d3m94a_ d.86.1.0 (A:) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
mrhplqchwalwylkadrskdwedclkqvavfdtvedfwslynhiqaasgltwgsdyylf
kegikpmwedennvkggrwlvvvdkqkraqlldhywlellmaiigeqfedngeyicgavv
nvrqkgdkvslwtrdslkddvnlrigqilkakleipdtepiryevhktgsmvkprivips

SCOPe Domain Coordinates for d3m94a_:

Click to download the PDB-style file with coordinates for d3m94a_.
(The format of our PDB-style files is described here.)

Timeline for d3m94a_: