Lineage for d3m5jb_ (3m5j B:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2238935Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2238936Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2238958Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2238997Domain d3m5jb_: 3m5j B: [239453]
    Other proteins in same PDB: d3m5ja_, d3m5jc_, d3m5je_
    automated match to d4n5zb_
    complexed with gol, nag

Details for d3m5jb_

PDB Entry: 3m5j (more details), 2.6 Å

PDB Description: Crystal structure of a H7 influenza virus hemagglutinin complexed with LSTb
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d3m5jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m5jb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn
qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye
rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnriqidsg

SCOPe Domain Coordinates for d3m5jb_:

Click to download the PDB-style file with coordinates for d3m5jb_.
(The format of our PDB-style files is described here.)

Timeline for d3m5jb_: