Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.0: automated matches [191381] (1 protein) not a true family |
Protein automated matches [190475] (10 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [255955] (1 PDB entry) |
Domain d3m4ub_: 3m4u B: [247609] automated match to d2h4vb_ complexed with po4 |
PDB Entry: 3m4u (more details), 2.39 Å
SCOPe Domain Sequences for d3m4ub_:
Sequence, based on SEQRES records: (download)
>d3m4ub_ c.45.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} mstaksfpmaqlstraqysrmqrefvqlqrqenprninfttslknrhknryldilaneet iyppvlkavgaqpgrypyingnlidldlphtfvacqapvpqgvpdfletlsekkvdlvvm ltklreggvlkaerywpeeeedslsfpesghdaikvtrdaeasyevdaeldivrrplvih vpgkpmhrvlqvqyvgwpdhgvpesaasfdellsvikncvttspilvhcsagigrtgtli gayaallhiergiltdstvysivaamkqkrfgmvqrleqyaviymtvlgrlgvdisgl
>d3m4ub_ c.45.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} mstaksfpmaqlstraqysrmqrefvqlqrqenprninfttslknrhknryldilaneet iyppvlypyingnlidldlphtfvacqapvpqgvpdfletlsekkvdlvvmltklreggv lkaerywpeeedslsfdaikvtrdaeasyevdaeldivrrplvihvpgkpmhrvlqvqyv gwpdhgvpesaasfdellsvikncvttspilvhcsagigrtgtligayaallhiergilt dstvysivaamkqkrfgmvqrleqyaviymtvlgrlgvdisgl
Timeline for d3m4ub_: