Lineage for d3m49a1 (3m49 A:2-337)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2865204Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2865205Protein automated matches [227126] (21 species)
    not a true protein
  7. 2865211Species Bacillus anthracis [TaxId:261594] [255872] (3 PDB entries)
  8. 2865216Domain d3m49a1: 3m49 A:2-337 [247599]
    Other proteins in same PDB: d3m49a3, d3m49b3
    automated match to d1itza1
    complexed with acy, btb, fmt, gol, mg, peg, pg5, so4, tdp, trs

Details for d3m49a1

PDB Entry: 3m49 (more details), 2 Å

PDB Description: crystal structure of transketolase complexed with thiamine diphosphate from bacillus anthracis
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d3m49a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m49a1 c.36.1.0 (A:2-337) automated matches {Bacillus anthracis [TaxId: 261594]}
shsieqlsintirtlsidaiekansghpgmpmgaapmaytlwtqfmkhnpnnptwfnrdr
fvlsaghgsmllysllhlsgydvtmddlknfrqwgsktpghpeyghtagvdattgplgqg
iatavgmamaerhlaakynrdaynivdhytyaicgdgdlmegvsaeasslaahlqlgrlv
vlydsndisldgdlnrsfsesvedrykaygwqvirvedgndieaiakaieeakadekrpt
lievrttigfgspnksgksashgsplgveetkltkeayawtaeqdfhvaeevyenfrktv
qdvgetaqaewntmlgeyaqaypelanelqaamngl

SCOPe Domain Coordinates for d3m49a1:

Click to download the PDB-style file with coordinates for d3m49a1.
(The format of our PDB-style files is described here.)

Timeline for d3m49a1: