![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
![]() | Protein automated matches [227126] (21 species) not a true protein |
![]() | Species Bacillus anthracis [TaxId:261594] [255872] (3 PDB entries) |
![]() | Domain d3m49a1: 3m49 A:2-337 [247599] Other proteins in same PDB: d3m49a3, d3m49b3 automated match to d1itza1 complexed with acy, btb, fmt, gol, mg, peg, pg5, so4, tdp, trs |
PDB Entry: 3m49 (more details), 2 Å
SCOPe Domain Sequences for d3m49a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m49a1 c.36.1.0 (A:2-337) automated matches {Bacillus anthracis [TaxId: 261594]} shsieqlsintirtlsidaiekansghpgmpmgaapmaytlwtqfmkhnpnnptwfnrdr fvlsaghgsmllysllhlsgydvtmddlknfrqwgsktpghpeyghtagvdattgplgqg iatavgmamaerhlaakynrdaynivdhytyaicgdgdlmegvsaeasslaahlqlgrlv vlydsndisldgdlnrsfsesvedrykaygwqvirvedgndieaiakaieeakadekrpt lievrttigfgspnksgksashgsplgveetkltkeayawtaeqdfhvaeevyenfrktv qdvgetaqaewntmlgeyaqaypelanelqaamngl
Timeline for d3m49a1: