Class a: All alpha proteins [46456] (286 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48550] (28 PDB entries) Uniprot Q07343 324-667 |
Domain d3ly2a_: 3ly2 A: [213095] automated match to d3d3pa_ complexed with mg, so4, z72, zn |
PDB Entry: 3ly2 (more details), 2.6 Å
SCOPe Domain Sequences for d3ly2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ly2a_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]} ssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaif qerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavft dleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehc difmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdr iqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasve ksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmip
Timeline for d3ly2a_: