Lineage for d3lvza_ (3lvz A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) 
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) Protein automated matches [190079] (12 species)
not a true protein
Species Bradyrhizobium japonicum [TaxId:224911] [226051] (4 PDB entries) 
Domain d3lvza_: 3lvz A: [213075]
automated match to d2gmna1
complexed with zn
Details for d3lvza_
PDB Entry: 3lvz (more details), 1.4 Å
PDB Description: New refinement of the crystal structure of BJP-1, a subclass B3 metallo-beta-lactamase of Bradyrhizobium japonicum
PDB Compounds: (A:) Blr6230 proteinSCOPe Domain Sequences for d3lvza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lvza_ d.157.1.1 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
ikdflavamkkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmikd
niaklgfkvadiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgdekn
edlafpavkvdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlffcs
gtvalnrlvgqptyagivddyratfakakamkidvllgphpevygmqakraemkdgapnp
fikpgelvtyatslsedfdkqlakqtaalekk
SCOPe Domain Coordinates for d3lvza_:
Click to download the PDB-style file with coordinates for d3lvza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3lvza_:
- d3lvza_ first appeared in SCOPe 2.03
- d3lvza_ appears in SCOPe 2.07
View in 3D
