Lineage for d3lqvb_ (3lqv B:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) 
Family d.58.7.1: Canonical RBD [54929] (68 proteins) 
Protein automated matches [190332] (5 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries) 
Domain d3lqvb_: 3lqv B: [180520]
automated match to d2f9da1
complexed with ade
Details for d3lqvb_
PDB Entry: 3lqv (more details), 2.38 Å
PDB Description: branch recognition by sf3b14
PDB Compounds: (B:) Pre-mRNA branch site protein p14SCOPe Domain Sequences for d3lqvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lqvb_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
irlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifda
knavdhlsgfnvsnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk
SCOPe Domain Coordinates for d3lqvb_:
Click to download the PDB-style file with coordinates for d3lqvb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3lqvb_:
- d3lqvb_ first appeared in SCOPe 2.01
- d3lqvb_ appears in SCOPe 2.05
- d3lqvb_ appears in SCOPe 2.07
- d3lqvb_ appears in the current release, SCOPe 2.08
View in 3D
