Lineage for d3lpxa_ (3lpx A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2572939Fold e.11: Type II DNA topoisomerase C-terminal domain-like [56718] (1 superfamily)
    4 domains: (1) toprim alpha/beta; (2) "winged helix"-like; (3) alpha+beta; (4) all-alpha
  4. 2572940Superfamily e.11.1: Type II DNA topoisomerase C-terminal domain-like [56719] (2 families) (S)
  5. 2572941Family e.11.1.1: Type II DNA topoisomerase C-terminal domain-like [56720] (3 proteins)
    domain 2 contains the catalytic tyrosine residue
  6. 2572966Protein automated matches [191158] (6 species)
    not a true protein
  7. 2572970Species Colwellia psychrerythraea [TaxId:167879] [189641] (1 PDB entry)
  8. 2572971Domain d3lpxa_: 3lpx A: [180501]
    automated match to d1ab4a_

Details for d3lpxa_

PDB Entry: 3lpx (more details), 2.6 Å

PDB Description: Crystal structure of GyrA
PDB Compounds: (A:) DNA gyrase, A subunit

SCOPe Domain Sequences for d3lpxa_:

Sequence, based on SEQRES records: (download)

>d3lpxa_ e.11.1.1 (A:) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
alpdvrdglkpvhrrvlfamdvlgndwnkaykksarvvgdvigkyhphgdtavydtivrm
aqpfslrymlvdgqgnfgsvdgdsaaamryteirmskiahsiladldketvdfvpnydgt
ehipavmptrvpnllvngtsgiavgmatnipphnltevinaclalidnseltfeeilehi
pgpdfptagiisgragieeayrtgrgkikirarasidvhettgketiivhelpyqvnkar
liekmaelvkdkrlegisalrdesdkdgmrmvieikrgevgevvlnnlykltqmqvsfgl
nmvaltngqpkifnikemleafvlhrrevvtrrtifelrkardrahileglsialanidp
iiemiknsnnrkeseeklisqgwelgnvanmlseagndaarpewlepeygirdglyylta
eqakaivdlqlyklsgmehdkilseykalldliaelmhilatparlmeviceelvairde
fgderrteit

Sequence, based on observed residues (ATOM records): (download)

>d3lpxa_ e.11.1.1 (A:) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
alpdvrdglkpvhrrvlfamdvlgndwnkaykksarvvgdvigkyhphgdtavydtivrm
aqpfslrymlvdgqgnfgsvdgdsaaamryteirmskiahsiladldketvdfvpnydgt
ehipavmptrvpnllvngtatnipphnltevinaclalidnseltfeeilehipgpdfpt
agiisgragieeayrtgrgkikirarasidvhettgketiivhelpyqvnkarliekmae
lvkdkrlegisalrdesdkdgmrmvieikrgevgevvlnnlykltqmqvsfglnmvaltn
gqpkifnikemleafvlhrrevvtrrtifelrkardrahileglsialanidpiiemikn
snnrkeseeklisqgwelgdaarpewlepetaeqakaivdlqlyklsgmehdkilseyka
lldliaelmhilatparlmeviceelvairdefgderrteit

SCOPe Domain Coordinates for d3lpxa_:

Click to download the PDB-style file with coordinates for d3lpxa_.
(The format of our PDB-style files is described here.)

Timeline for d3lpxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3lpxb_