Lineage for d3lida1 (3lid A:33-206)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2577489Superfamily d.110.6: Sensory domain-like [103190] (5 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 2577514Family d.110.6.2: YkuI C-terminal domain-like [143732] (2 proteins)
    PfamB PB021678
  6. 2577515Protein GGDEF family protein VP0354 [160677] (1 species)
    N-terminal region, consist of two sensory domain-like domains; there is a canonical sensory (PAS) domain in the middle region
  7. 2577516Species Vibrio parahaemolyticus [TaxId:670] [160678] (3 PDB entries)
    Uniprot Q87SR8 207-299! Uniprot Q87SR8 35-206
  8. 2577521Domain d3lida1: 3lid A:33-206 [232842]
    automated match to d2p7jb2
    complexed with cl, edo, po4

Details for d3lida1

PDB Entry: 3lid (more details), 1.76 Å

PDB Description: crystal structure of the extracellular domain of the putative histidine kinase vphk1s-z8
PDB Compounds: (A:) Putative sensory box/GGDEF family protein

SCOPe Domain Sequences for d3lida1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lida1 d.110.6.2 (A:33-206) GGDEF family protein VP0354 {Vibrio parahaemolyticus [TaxId: 670]}
lannventakealhqlaytgreynniqdqietisdllghsqslydylrepskanltilen
mwssvarnqklykqirfldtsgtekvrikydfktsiagpslilrdksareyfkyaqsldn
eqisawgielerdkgelvyplspslrilmpisvndvrqgylvlnvdieylssll

SCOPe Domain Coordinates for d3lida1:

Click to download the PDB-style file with coordinates for d3lida1.
(The format of our PDB-style files is described here.)

Timeline for d3lida1:

2577521
d3lida1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3lida2