Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
Protein automated matches [190670] (6 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [189389] (1 PDB entry) |
Domain d3lf0a_: 3lf0 A: [180240] automated match to d1hwua_ complexed with atp |
PDB Entry: 3lf0 (more details), 2.4 Å
SCOPe Domain Sequences for d3lf0a_:
Sequence, based on SEQRES records: (download)
>d3lf0a_ d.58.5.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} shmklitaivkpftlddvktsledagvlgmtvseiqgygrqkghtevyrgaeysvdfvpk vrievvvddsivdkvvdsivraartgkigdgkvwvspvdtivrvrtgerghdal
>d3lf0a_ d.58.5.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} shmklitaivkpftlddvktsledagvlgmtvseiqgygrdfvpkvrievvvddsivdkv vdsivraartgkigdgkvwvspvdtivrvrtgerghdal
Timeline for d3lf0a_: