Lineage for d3lc3a_ (3lc3 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1793534Protein Coagulation factor IXa, protease domain [50583] (2 species)
  7. 1793535Species Human (Homo sapiens) [TaxId:9606] [50585] (9 PDB entries)
  8. 1793539Domain d3lc3a_: 3lc3 A: [180171]
    Other proteins in same PDB: d3lc3b_, d3lc3d_
    automated match to d1rfna_
    complexed with ca, iyx

Details for d3lc3a_

PDB Entry: 3lc3 (more details), 1.9 Å

PDB Description: Benzothiophene Inhibitors of Factor IXa
PDB Compounds: (A:) coagulation factor ix

SCOPe Domain Sequences for d3lc3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lc3a_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnynaainkynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftiynnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt

SCOPe Domain Coordinates for d3lc3a_:

Click to download the PDB-style file with coordinates for d3lc3a_.
(The format of our PDB-style files is described here.)

Timeline for d3lc3a_: