Lineage for d3lb8c_ (3lb8 C:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) 
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) 
Protein 2Fe-2S ferredoxin [54294] (19 species) 
Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (18 PDB entries) 
Domain d3lb8c_: 3lb8 C: [180158]
automated match to d1oqqa_
complexed with fad, fes
Details for d3lb8c_
PDB Entry: 3lb8 (more details), 2.6 Å
PDB Description: crystal structure of the covalent putidaredoxin reductase- putidaredoxin complex
PDB Compounds: (C:) putidaredoxinSCOPe Domain Sequences for d3lb8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lb8c_ d.15.4.1 (C:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdr
SCOPe Domain Coordinates for d3lb8c_:
Click to download the PDB-style file with coordinates for d3lb8c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3lb8c_:
- d3lb8c_ first appeared in SCOPe 2.01
- d3lb8c_ appears in SCOPe 2.04
- d3lb8c_ appears in SCOPe 2.06
- d3lb8c_ appears in the current release, SCOPe 2.08
View in 3D
