Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices |
Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins) Pfam PF03259 |
Protein automated matches [190414] (3 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189327] (2 PDB entries) |
Domain d3l7hb_: 3l7h B: [180049] automated match to d1z09a1 |
PDB Entry: 3l7h (more details), 1.95 Å
SCOPe Domain Sequences for d3l7hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l7hb_ d.110.7.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} msqeveetlkriqshkgvvgtivvnnegipvkstldntttvqyaglmsqladkarsvvrd ldpsndmtflrvrskkheimvapdkdfiliviqn
Timeline for d3l7hb_: