Lineage for d3l75p1 (3l75 P:2-261)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024525Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 3024526Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 3024532Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 3024543Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
    also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits
  7. 3024551Species Chicken (Gallus gallus) [TaxId:9031] [81639] (8 PDB entries)
  8. 3024557Domain d3l75p1: 3l75 P:2-261 [199715]
    Other proteins in same PDB: d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75c2, d3l75d1, d3l75d2, d3l75e1, d3l75e2, d3l75f_, d3l75g_, d3l75h_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p2, d3l75q1, d3l75q2, d3l75r1, d3l75r2, d3l75s_, d3l75t_, d3l75u_, d3l75w_
    automated match to d1bccc3
    complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq

Details for d3l75p1

PDB Entry: 3l75 (more details), 2.79 Å

PDB Description: cytochrome bc1 complex from chicken with fenamidone bound
PDB Compounds: (P:) cytochrome b

SCOPe Domain Sequences for d3l75p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l75p1 f.21.1.2 (P:2-261) Mitochondrial cytochrome b subunit, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts
lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill
ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa
lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl
tlalfspnllgdpenftpan

SCOPe Domain Coordinates for d3l75p1:

Click to download the PDB-style file with coordinates for d3l75p1.
(The format of our PDB-style files is described here.)

Timeline for d3l75p1:

3024557
d3l75p1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3l75p2