Lineage for d3l70e2 (3l70 E:70-196)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391958Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2391959Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2391960Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 2392045Protein automated matches [190874] (7 species)
    not a true protein
  7. 2392050Species Chicken (Gallus gallus) [TaxId:9031] [260680] (8 PDB entries)
  8. 2392051Domain d3l70e2: 3l70 E:70-196 [260681]
    Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70e1, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70p2, d3l70q1, d3l70q2, d3l70r1, d3l70s_, d3l70t_, d3l70u_, d3l70w_
    automated match to d1bcce1
    complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70e2

PDB Entry: 3l70 (more details), 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound
PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d3l70e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l70e2 b.33.1.1 (E:70-196) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
alskieiklsdipegknvafkwrgkplfvrhrtqaeinqeaevdvsklrdpqhdldrvkk
pewvilvgvcthlgcvpiansgdfggyycpchgshydasgrirkgpapynlevptyqfvg
ddlvvvg

SCOPe Domain Coordinates for d3l70e2:

Click to download the PDB-style file with coordinates for d3l70e2.
(The format of our PDB-style files is described here.)

Timeline for d3l70e2: