Lineage for d3kyua_ (3kyu A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965821Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1966025Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1966026Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1966035Protein Rubredoxin [57804] (8 species)
  7. 1966095Species Pyrococcus furiosus [TaxId:2261] [57809] (25 PDB entries)
    Uniprot P24297
  8. 1966107Domain d3kyua_: 3kyu A: [179814]
    automated match to d1bq8a_
    complexed with dod, fe

Details for d3kyua_

PDB Entry: 3kyu (more details), 1.1 Å

PDB Description: x-ray crystal structure determination of fully perdeuterated rubredoxin at 100k
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d3kyua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kyua_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled

SCOPe Domain Coordinates for d3kyua_:

Click to download the PDB-style file with coordinates for d3kyua_.
(The format of our PDB-style files is described here.)

Timeline for d3kyua_: