Lineage for d3kwta_ (3kwt A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045100Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045101Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2045347Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2045348Protein automated matches [190497] (4 species)
    not a true protein
  7. 2045383Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (10 PDB entries)
  8. 2045387Domain d3kwta_: 3kwt A: [179759]
    automated match to d2ep6a1
    complexed with b3p, cl

Details for d3kwta_

PDB Entry: 3kwt (more details), 1.89 Å

PDB Description: munc13-1 c2b-domain, calcium-free
PDB Compounds: (A:) Munc13-1

SCOPe Domain Sequences for d3kwta_:

Sequence, based on SEQRES records: (download)

>d3kwta_ b.7.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sakisitvvcaqglqakdktgssdpyvtvqvgktkkrtktiygnlnpvweenfhfechns
sdrikvrvldedddiksrvkqrfkresddflgqtiievrtlsgemdvwynldkrtdksav
sgairlhisvei

Sequence, based on observed residues (ATOM records): (download)

>d3kwta_ b.7.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sakisitvvcaqglqakdgssdpyvtvqvgktkkrtktiygnlnpvweenfhfechnssd
rikvrvldedddikesddflgqtiievrtlsgemdvwynldkrvsgairlhisvei

SCOPe Domain Coordinates for d3kwta_:

Click to download the PDB-style file with coordinates for d3kwta_.
(The format of our PDB-style files is described here.)

Timeline for d3kwta_: