Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) |
Family d.90.1.0: automated matches [191446] (1 protein) not a true family |
Protein automated matches [190672] (32 species) not a true protein |
Species Bacteroides thetaiotaomicron [TaxId:226186] [232733] (1 PDB entry) |
Domain d3kwka_: 3kwk A: [232734] automated match to d4dn2b_ complexed with cl, fmn, unl |
PDB Entry: 3kwk (more details), 1.54 Å
SCOPe Domain Sequences for d3kwka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kwka_ d.90.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} tgnaaldniferksvrtylnkgvekekidlmlragmsapsgkdvrpwefvvvsdraklds maaalpyakmltqarnaiivcgdsarsfywyldcsaaaqnillaaesmglgavwtaaypy edrmevvrkythlpenilplcvipfgypatkeqpkqkydekkihynqy
Timeline for d3kwka_: