Lineage for d3kksb_ (3kks B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1860195Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 1860196Protein automated matches [190396] (30 species)
    not a true protein
  7. 1860208Species Bovine immunodeficiency virus [TaxId:417296] [225970] (2 PDB entries)
  8. 1860210Domain d3kksb_: 3kks B: [212403]
    automated match to d4jlha_
    complexed with act, gol

Details for d3kksb_

PDB Entry: 3kks (more details), 2.2 Å

PDB Description: Crystal structure of catalytic core domain of BIV integrase in crystal form II
PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d3kksb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kksb_ c.55.3.0 (B:) automated matches {Bovine immunodeficiency virus [TaxId: 417296]}
gshlwqmdnthwnktiiwvavetnsglveaqvipeetalqvalcilqliqrytvlhlhsd
ngpcftahrienlckylgitkttgipynpqsqgvverahrdlkdrlaayqgdcetveaal
slalvslnkkrggigghtpyeiylesehtkyq

SCOPe Domain Coordinates for d3kksb_:

Click to download the PDB-style file with coordinates for d3kksb_.
(The format of our PDB-style files is described here.)

Timeline for d3kksb_: