Lineage for d3kkeb_ (3kke B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913463Species Mycobacterium smegmatis [TaxId:246196] [232714] (3 PDB entries)
  8. 2913467Domain d3kkeb_: 3kke B: [232716]
    automated match to d4kmra_
    complexed with act

Details for d3kkeb_

PDB Entry: 3kke (more details), 2.2 Å

PDB Description: crystal structure of a laci family transcriptional regulator from mycobacterium smegmatis
PDB Compounds: (B:) LacI family Transcriptional regulator

SCOPe Domain Sequences for d3kkeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kkeb_ c.93.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
nararalrhsrsgtiglivpdvnnavfadmfsgvqmaasghstdvllgqidapprgtqql
srlvsegrvdgvllqrredfdddmlaavlegvpavtinsrvpgrvgsvilddqkgggiat
ehlitlghsriafisgtaihdtaqrrkegyletlasaglrseaawvvdagweadagsaal
ntlyrganlgkpdgptavvvasvnaavgalstalrlglrvpedlsivginttwvsdtvyp
alttvrlplqrlgevaadvlmehlggraltdtvvtqptpellvrettappt

SCOPe Domain Coordinates for d3kkeb_:

Click to download the PDB-style file with coordinates for d3kkeb_.
(The format of our PDB-style files is described here.)

Timeline for d3kkeb_: