Lineage for d3khqa_ (3khq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759739Domain d3khqa_: 3khq A: [212356]
    automated match to d1i8ka_
    complexed with flc, gsh, mg

Details for d3khqa_

PDB Entry: 3khq (more details), 1.7 Å

PDB Description: crystal structure of murine ig-beta (cd79b) in the monomeric form
PDB Compounds: (A:) B-cell antigen receptor complex-associated protein beta chain

SCOPe Domain Sequences for d3khqa_:

Sequence, based on SEQRES records: (download)

>d3khqa_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
csqiwqhprfaakkrssmvkfhcytnhsgaltwfrkrgsqqpqelvseegrivqtqngsv
ytltiqniqyedngiyfckqkcdsanhnvtdscgtellvl

Sequence, based on observed residues (ATOM records): (download)

>d3khqa_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
csqiwqhprfaakkrssmvkfhcytnhsgaltwfrkrgsqqpqelvseegrivqtqngsv
ytltiqniqyedngiyfckqkcdsscgtellvl

SCOPe Domain Coordinates for d3khqa_:

Click to download the PDB-style file with coordinates for d3khqa_.
(The format of our PDB-style files is described here.)

Timeline for d3khqa_: