Lineage for d3kfla1 (3kfl A:207-574)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2860973Species Leishmania major [TaxId:5664] [267846] (2 PDB entries)
  8. 2860974Domain d3kfla1: 3kfl A:207-574 [264972]
    Other proteins in same PDB: d3kfla2
    automated match to d4eg8b1
    protein/RNA complex; complexed with edo, fmt, me8, mg, pop, zn

Details for d3kfla1

PDB Entry: 3kfl (more details), 2 Å

PDB Description: Leishmania major methionyl-tRNA synthetase in complex with methionyladenylate and pyrophosphate
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d3kfla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kfla1 c.26.1.0 (A:207-574) automated matches {Leishmania major [TaxId: 5664]}
kqkvffattpiyyvnasphighvystlivdvlgryhrvkgeevfvmtgtdehgqkvaeaa
akqgvspmdfttsvssefkqcfqemnydmnyfirttnptheklvqdiwkklaakgdiylg
kyegwysvsdesfltaqnvadgvdrdgkpckvslesghvvtwveeenymfrlsafrerll
kyfhdhpncivpefrrreviktvekglfdlsisrkresvmnwsipvpgderhciyvwlda
lfnyytgaltrvatdgtetldedhhalnrwpadvhvvgkdilkfhaiywpaflmsaelpl
perlvshgwwtkdhkkiskslgnafdpvekakefgidalkyflmresnfqddgdysdknm
varlngel

SCOPe Domain Coordinates for d3kfla1:

Click to download the PDB-style file with coordinates for d3kfla1.
(The format of our PDB-style files is described here.)

Timeline for d3kfla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kfla2