Lineage for d3kd0a_ (3kd0 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876445Protein automated matches [190442] (13 species)
    not a true protein
  7. 2876477Species Human (Homo sapiens) [TaxId:9606] [189547] (7 PDB entries)
  8. 2876479Domain d3kd0a_: 3kd0 A: [179283]
    automated match to d1erva_
    complexed with cd, cl; mutant

Details for d3kd0a_

PDB Entry: 3kd0 (more details), 1.7 Å

PDB Description: human thioredoxin c35s,c62s,c69s,c73s mutant showing cadmium chloride bound to the active site
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d3kd0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kd0a_ c.47.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkqiesktafqealdaagdklvvvdfsatwcgpskmikpffhslsekysnviflevdvdd
sqdvasesevksmptfqffkkgqkvgefsgankekleatinelv

SCOPe Domain Coordinates for d3kd0a_:

Click to download the PDB-style file with coordinates for d3kd0a_.
(The format of our PDB-style files is described here.)

Timeline for d3kd0a_: