Lineage for d3kbna_ (3kbn A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839095Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 2839096Protein D-xylose isomerase [51666] (13 species)
  7. 2839224Species Streptomyces rubiginosus [TaxId:1929] [51670] (89 PDB entries)
  8. 2839257Domain d3kbna_: 3kbn A: [179239]
    automated match to d1dxia_
    complexed with glo, ni

Details for d3kbna_

PDB Entry: 3kbn (more details), 1.53 Å

PDB Description: room temperature structure of d-xylose isomerase in complex with 2ni(2+) co-factors and d12-d-glucose in the linear form
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d3kbna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kbna_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces rubiginosus [TaxId: 1929]}
mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlip
fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
dvdaaaargmaferldqlamdhllgarg

SCOPe Domain Coordinates for d3kbna_:

Click to download the PDB-style file with coordinates for d3kbna_.
(The format of our PDB-style files is described here.)

Timeline for d3kbna_: