Lineage for d3jvga2 (3jvg A:181-276)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754067Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)
  8. 2754090Domain d3jvga2: 3jvg A:181-276 [199590]
    Other proteins in same PDB: d3jvga1, d3jvga3, d3jvgb1, d3jvgb3
    automated match to d1gzqa1
    complexed with cl, nag, unl

Details for d3jvga2

PDB Entry: 3jvg (more details), 2.2 Å

PDB Description: crystal structure of chicken cd1-1
PDB Compounds: (A:) T-cell surface glycoprotein CD1A1 antigen

SCOPe Domain Sequences for d3jvga2:

Sequence, based on SEQRES records: (download)

>d3jvga2 b.1.1.0 (A:181-276) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
qvppmavvfartagqaqlllvcrvtsfyprpiavtwlrdgrevppspalstgtvlpnadl
tyqlrstllvspqdghgyacrvqhcslgdrsllvpw

Sequence, based on observed residues (ATOM records): (download)

>d3jvga2 b.1.1.0 (A:181-276) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
qvppmavvfartaqlllvcrvtsfyprpiavtwlrdgrevppspalstgtvlpnadltyq
lrstllvsphgyacrvqhcslgrsllvpw

SCOPe Domain Coordinates for d3jvga2:

Click to download the PDB-style file with coordinates for d3jvga2.
(The format of our PDB-style files is described here.)

Timeline for d3jvga2: