Lineage for d3juza_ (3juz A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2038572Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2038676Protein automated matches [226855] (1 species)
    not a true protein
  7. 2038677Species Mouse (Mus musculus) [TaxId:10090] [224977] (9 PDB entries)
  8. 2038681Domain d3juza_: 3juz A: [212115]
    automated match to d1my5a_
    mutant

Details for d3juza_

PDB Entry: 3juz (more details), 2.51 Å

PDB Description: crystal structure of a mutant of relb dimerization domain(m5)
PDB Compounds: (A:) transcription factor relb

SCOPe Domain Sequences for d3juza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3juza_ b.1.18.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tselricridkesgpctggeelyllcdkvqkedisvrfstaswegrgdfsqadvhrqiai
vfktppyedleisepvtvnvqlqrltdgecseplpftylpr

SCOPe Domain Coordinates for d3juza_:

Click to download the PDB-style file with coordinates for d3juza_.
(The format of our PDB-style files is described here.)

Timeline for d3juza_: