Lineage for d3jtha_ (3jth A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984669Species Vibrio vulnificus [TaxId:216895] [267843] (1 PDB entry)
  8. 1984670Domain d3jtha_: 3jth A: [264958]
    automated match to d4k2ea_

Details for d3jtha_

PDB Entry: 3jth (more details), 2 Å

PDB Description: Crystal structure of a transcriptional regulator HlyU from Vibrio vulnificus CMCP6
PDB Compounds: (A:) Transcription activator HlyU

SCOPe Domain Sequences for d3jtha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jtha_ a.4.5.0 (A:) automated matches {Vibrio vulnificus [TaxId: 216895]}
mnlkdmeqnsakavvllkamanerrlqilcmlhnqelsvgelcaklqlsqsalsqhlawl
rrdglvttrkeaqtvyytlkseevkamikllhslyc

SCOPe Domain Coordinates for d3jtha_:

Click to download the PDB-style file with coordinates for d3jtha_.
(The format of our PDB-style files is described here.)

Timeline for d3jtha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3jthb_