Lineage for d3iu1a2 (3iu1 A:296-496)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
3 layers: a/b/a; contains mixed beta-sheetSuperfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) 
Family d.108.1.0: automated matches [191308] (1 protein)
not a true familyProtein automated matches [190038] (49 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries) 
Domain d3iu1a2: 3iu1 A:296-496 [211953]
automated match to d1iyka2
complexed with mya
Details for d3iu1a2
PDB Entry: 3iu1 (more details), 1.42 Å
PDB Description: Crystal Structure of human type-I N-myristoyltransferase with bound myristoyl-CoA
PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase 1SCOPe Domain Sequences for d3iu1a2:
Sequence, based on SEQRES records: (download)
>d3iu1a2 d.108.1.0 (A:296-496) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltr
ylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthks
lkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlq
yylynwkcpsmgaekvglvlq
Sequence, based on observed residues (ATOM records): (download)
>d3iu1a2 d.108.1.0 (A:296-496) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ywhrslnprklievkfshlnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltryl
kqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthkslk
aaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlqyy
lynwkcpsmgaekvglvlq
SCOPe Domain Coordinates for d3iu1a2:
Click to download the PDB-style file with coordinates for d3iu1a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3iu1a2:
- d3iu1a2 first appeared in SCOPe 2.03
- d3iu1a2 appears in SCOPe 2.07
View in 3D
