Lineage for d3ir4a2 (3ir4 A:76-215)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) 
Protein automated matches [226848] (10 species)
not a true proteinSpecies Salmonella enterica [TaxId:99287] [225743] (1 PDB entry) 
Domain d3ir4a2: 3ir4 A:76-215 [211846]
Other proteins in same PDB: d3ir4a1
automated match to d1g7oa1
complexed with cl, gsh, so4
Details for d3ir4a2
PDB Entry: 3ir4 (more details), 1.2 Å
PDB Description: 1.2 angstrom crystal structure of the glutaredoxin 2 (grxb) from salmonella typhimurium in complex with glutathione
PDB Compounds: (A:) glutaredoxin 2SCOPe Domain Sequences for d3ir4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ir4a2 a.45.1.1 (A:76-215) automated matches {Salmonella enterica [TaxId: 99287]}
plltgkrnpaieewlrkvngyvnqlllprfaksafdefstpaarqyfirkkeassgsfdn
hlahsaglikkigddlrlldklivqpnavngelseddihlfpllrnltlvagihwptkva
dyrdnmakqtqinllssmai
SCOPe Domain Coordinates for d3ir4a2:
Click to download the PDB-style file with coordinates for d3ir4a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ir4a2:
- d3ir4a2 first appeared in SCOPe 2.03
- d3ir4a2 appears in SCOPe 2.05
- d3ir4a2 appears in the current release, SCOPe 2.08
View in 3D
