Lineage for d3ip7a_ (3ip7 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1878506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1878507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1878777Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 1878778Protein automated matches [190646] (60 species)
    not a true protein
  7. 1878789Species Agrobacterium tumefaciens [TaxId:176299] [225916] (6 PDB entries)
  8. 1878795Domain d3ip7a_: 3ip7 A: [211837]
    automated match to d1usga_
    complexed with ca, val

Details for d3ip7a_

PDB Entry: 3ip7 (more details), 1.7 Å

PDB Description: Structure of Atu2422-GABA receptor in complex with valine
PDB Compounds: (A:) ABC transporter, substrate binding protein (Amino acid)

SCOPe Domain Sequences for d3ip7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ip7a_ c.93.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
mdvviavgapltgpnaafgaqiqkgaeqaakdinaaggingeqikivlgddvsdpkqgis
vankfvadgvkfvvghfnsgvsipasevyaengileitpaatnpvfterglwntfrtcgr
ddqqggiagkyladhfkdakvaiihdktpygqgladetkkaanaagvtevmyegvnvgdk
dfsaliskmkeagvsiiywgglhteagliirqaadqglkaklvsgdgivsnelasiagda
vegtlntfgpdptlrpenkelvekfkaagfnpeaytlysyaamqaiagaakaagsvepek
vaealkkgsfptalgeisfdekgdpklpgyvmyewkkgpdgkftyiqq

SCOPe Domain Coordinates for d3ip7a_:

Click to download the PDB-style file with coordinates for d3ip7a_.
(The format of our PDB-style files is described here.)

Timeline for d3ip7a_: