Lineage for d3ifzb_ (3ifz B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2572939Fold e.11: Type II DNA topoisomerase C-terminal domain-like [56718] (1 superfamily)
    4 domains: (1) toprim alpha/beta; (2) "winged helix"-like; (3) alpha+beta; (4) all-alpha
  4. 2572940Superfamily e.11.1: Type II DNA topoisomerase C-terminal domain-like [56719] (2 families) (S)
  5. 2572989Family e.11.1.0: automated matches [191600] (1 protein)
    not a true family
  6. 2572990Protein automated matches [191091] (5 species)
    not a true protein
  7. 2572994Species Mycobacterium tuberculosis [TaxId:83332] [225936] (1 PDB entry)
  8. 2572996Domain d3ifzb_: 3ifz B: [211670]
    automated match to d3lpxa_
    complexed with mpd, na

Details for d3ifzb_

PDB Entry: 3ifz (more details), 2.7 Å

PDB Description: crystal structure of the first part of the mycobacterium tuberculosis dna gyrase reaction core: the breakage and reunion domain at 2.7 a resolution
PDB Compounds: (B:) DNA gyrase subunit A

SCOPe Domain Sequences for d3ifzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ifzb_ e.11.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
idyamsvivgralpevrdglkpvhrrvlyamfdsgfrpdrshaksarsvaetmgnyhphg
dasiydslvrmaqpwslryplvdgqgnfgspgndppaamrytearltplamemlreidee
tvdfipnydgrvqeptvlpsrfpnllangsggiavgmatnipphnlreladavfwalenh
dadeeetlaavmgrvkgpdfptaglivgsqgtadayktgrgsirmrgvveveedsrgrts
lvitelpyqvnhdnfitsiaeqvrdgklagisniedqssdrvglrivieikrdavakvvi
nnlykhtqlqtsfganmlaivdgvprtlrldqliryyvdhqldvivrrttyrlrkanera
hilrglvkaldaldevialirasetvdiaraglielldideiqaqaildmqlrrlaaler
qriiddlakieaeiadledilakperqrgivrdelaeivdrhgddrrtriiaa

SCOPe Domain Coordinates for d3ifzb_:

Click to download the PDB-style file with coordinates for d3ifzb_.
(The format of our PDB-style files is described here.)

Timeline for d3ifzb_: