Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (47 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [189014] (1 PDB entry) |
Domain d3id6c_: 3id6 C: [178242] automated match to d1prya_ protein/RNA complex; complexed with sam |
PDB Entry: 3id6 (more details), 2.6 Å
SCOPe Domain Sequences for d3id6c_:
Sequence, based on SEQRES records: (download)
>d3id6c_ c.66.1.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} itvkqtnmeniyecefndgsfrlctrnlvpnfnvygerlikyegveyrewnafrsklaga ilkglktnpirkgtkvlylgaasgttishvsdiielngkaygvefsprvvrelllvaqrr pnifplladarfpqsyksvvenvdvlyvdiaqpdqtdiaiynakfflkvngdmllvikar sidvtkdpkeiykteveklensnfetiqiinldpydkdhaivlskyk
>d3id6c_ c.66.1.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} itvkqtnmeniyecefndgsfrlctrnlvpnfnvygerlikyegveyrewnafrsklaga ilkglktnpirkgtkvlylgaasgttishvsdiielngkaygvefsprvvrelllvaqrr pnifplladarfpqsyksvvenvdvlyvdiaqpdqtdiaiynakfflkvngdmllvikkd pkeiykteveklensnfetiqiinldpydkdhaivlskyk
Timeline for d3id6c_: