Class b: All beta proteins [48724] (180 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188766] (28 PDB entries) |
Domain d3iaib_: 3iai B: [178212] Other proteins in same PDB: d3iaia2 automated match to d1rj5a_ complexed with azm, gol, po4, trs, zn |
PDB Entry: 3iai (more details), 2.2 Å
SCOPe Domain Sequences for d3iaib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iaib_ b.74.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hwryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnng hsvqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstaf arvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallps dfsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratq plngrvieasfp
Timeline for d3iaib_:
View in 3D Domains from other chains: (mouse over for more information) d3iaia1, d3iaia2, d3iaic_, d3iaid_ |