Lineage for d3i54b2 (3i54 B:145-223)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1480132Species Mycobacterium tuberculosis [TaxId:1773] [187939] (6 PDB entries)
  8. 1480135Domain d3i54b2: 3i54 B:145-223 [232549]
    Other proteins in same PDB: d3i54a1, d3i54b1, d3i54c1, d3i54d1
    automated match to d3r6sd2
    protein/DNA complex; complexed with cmp

Details for d3i54b2

PDB Entry: 3i54 (more details), 2.2 Å

PDB Description: crystal structure of mtbcrp in complex with camp
PDB Compounds: (B:) transcriptional regulator, Crp/Fnr family

SCOPe Domain Sequences for d3i54b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i54b2 a.4.5.0 (B:145-223) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi
rlegksvlisdserlarra

SCOPe Domain Coordinates for d3i54b2:

Click to download the PDB-style file with coordinates for d3i54b2.
(The format of our PDB-style files is described here.)

Timeline for d3i54b2: