Lineage for d3hylb3 (3hyl B:528-666)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2135231Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2135232Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2135398Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. 2135399Protein automated matches [226991] (9 species)
    not a true protein
  7. 2135400Species Bacillus anthracis [TaxId:261594] [255873] (3 PDB entries)
  8. 2135406Domain d3hylb3: 3hyl B:528-666 [246619]
    Other proteins in same PDB: d3hyla1, d3hyla2, d3hylb1, d3hylb2
    automated match to d1itza3
    complexed with cl, fmt, gol, mg, peg, so4

Details for d3hylb3

PDB Entry: 3hyl (more details), 2.16 Å

PDB Description: crystal structure of transketolase from bacillus anthracis
PDB Compounds: (B:) transketolase

SCOPe Domain Sequences for d3hylb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hylb3 c.48.1.0 (B:528-666) automated matches {Bacillus anthracis [TaxId: 261594]}
egakddtyekvakgayvvsaskketadvillatgsevslaveaqkalavdgvdasvvsmp
smdrfeaqtaeykesvlpkavtkrfaiemgatfgwhryvglegdvlgidtfgasapgeki
meeygftvenvvrkvkeml

SCOPe Domain Coordinates for d3hylb3:

Click to download the PDB-style file with coordinates for d3hylb3.
(The format of our PDB-style files is described here.)

Timeline for d3hylb3: